McDonnell Genome Institute

Washington University

CircRNA

chr13|23365165|23375269|-|SACS|ENST00000382292.7

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9431

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

GAGVLDR

Amino Acids from 5' Exons

ELIQNAEDAGATEVKFLYDETQYGTETLWSKDMAPYQ,NFRMQKMLGRQKLNFYMMKLNTEQRLFGQKIWRHIR,INSECRRCWGDRSIFINSIRNRDSLVKRYGAIS

Amino Acids from 3' Exons

VGPGDRAPRLRGLQDRRGAGVLDRARCEGTYLRGDWLPGVGAAAVARRPR,WVPVTVLPGCVGCRTVAALASWTVRDVKERIFAETGFPVSEQRLWRGGRE,GSRPCSPAAWAAGPSRRWRPGPCAMRNVSSRRLASRCRSSGCGAAAA