McDonnell Genome Institute

Washington University

CircRNA

chr13|21502925|21514418|-|MICU2|ENST00000382374.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9168

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

LSAGELQK

Amino Acids from 5' Exons

IYGKFTNRDSRNGIPSVFRFEFHEKRRLCRVATFFHHKRYLLEKCEREVVSRR,FMENLQTEIQEMEFLQFSKGLSFMRKEDFAEWLLFFTNTENKDIYWKNVREKLSAGE,LWKIYKQRFKKWNSFSFLKVVSEKKTLQSGYFFSLTLKIKIFIGKMERSCQQE

Amino Acids from 3' Exons

LQKIISKQDDLMTVKTNETGYQ,CRRSVNKMTQKLMKLDI,AEDHKTRLDDSENNWIS