McDonnell Genome Institute

Washington University

CircRNA

chr13|20987880|20991404|-|LATS2|ENST00000382592.4

Cancer

Type of Peptide

BRCA-Luminal B

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9986

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

2

Peptide

FRPLPFPSAK

Amino Acids from 5' Exons

ERGSCQPQRGGPASKEPAIRLRPTTSAVPPTRAQASALTAPRRWRRCRGRTWTTFSPESAPTGPATSTSTHPRATVPARQQGHTSRCRARTTGGRTCWCLGNPWATECSAAPPSRARRRRRPGVTPACPRRAREDRQAPASLSHPLPPGSTCRTHTTSRPVPRPTSCMCWAPAARCSPATAPRRACSLPRGTASTWTCMNWAAPPSSSGRLPPWPAGTPCRSRAWRRRRARTWPSGLTAQCPAGPTPSTATSRGPVRLARPSPPCPPPTPRLSRPRTSCTRRACVCGRSRRRLWGPRTPPGCPRLPRPPPPPPPRLRRAWTPRRSMPWRWAAQAPSRWTWSTEAQTGGARLRPTRSTCCCAASRSSTTWTACAQAWSRASVRAPTSPRAATRAAKAPRGTKAERIKSRFRPLPFPSAKTAETKRRESHASRATRHTPLSSSWSSTWRMSSKPTSRRLTGGCSWSKKWP,KGAHANPSDAEAQLRRNRRFVCVLPPAERYPLRGPKLRRRPHGAGGDAAAVRGLPFPRSRPPRARPPAPAPTQGLRCQRRGSRGTLPAAGRALRAAAPAGAWGTPGLRSAAQPLLPEQDAAGDRGLRQPAHEGPGRTARRRPRFPTPCRRALRAAPTPQAGRSRGPPAACAGLPQPGVRQRQPPAEPAHSLAEQPQRGPVIGQHLRPAVAGCHPGPPGLPAEAGPGGAAARARGLPALPSAQQDQLLQQPPAAARSAWQGRALPARPQHRDGCHGRAHLAPGEERACAEAGAADGCGALAPRLGARACPGPRPRPRPGCGGLGRQGGACPGAGRRRRLPAGRGVRRPRPEVPASALPEAPAAAQQVGAVRPGQPVRRHGAEPPCGPQRARGRRQEPQKRQGGQRRKGKADSDLSRSRPQKQQRRREERVTHQELLAIRLVLHGAARGECHQNLPAEGPEAAAGARNGQ,KGLMPTPVTRRPSFEGTGDSFASYHQLSGTPYEGPSFGADGPTALEEMPRPYVDYLFPGVGPHGPGHQHQHPPKGYGASVEAAGAHFPLQGAHYGRPHLLVPGEPLGYGVQRSPSFQSKTPPETGGYASLPTKGQGGPPGAGLAFPPPAAGLYVPHPHHKQAGPAAHQLHVLGSRSQVFASDSPPQSLLTPSRNSLNVDLYELGSTSVQQWPAATLARRDSLQKPGLEAPPRAHVAFRPDCPVPSRTNSFNSHQPRPGPPGKAEPSLPAPNTVTAVTAAHILHPVKSVRVLRPEPQTAVGPSHPAWVPAPAPAPAPAPAPAAEGLDAKEEHALALGGAGAFPLDVEYGGPDRRCPPPPYPKHLLLRSKSEQYDLDSLCAGMEQSLRAGPNEPEGGDKSRKSAKGDKGGKDKKQIQTSPVPVRKNSRDEEKRESRIKSYSPYAFKFFMEQHVENVIKTYQQKVNRRLQLEQEMAK

Amino Acids from 3' Exons

EMAGRALKQTGSRSIEAALEYISKMGYLDPRNEQIVRVIKQTSP,RWLAELSSRLAAGASRPPWSTSARWATWTRGMSRLCGSLSRPPQ,DGWPSSQADWQQEHRGRPGVHQQDGLPGPEEADCAGHADLP