McDonnell Genome Institute

Washington University

CircRNA

chr13|20807456|20855765|-|XPO4|ENST00000255305.10

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9178

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

3

Peptide

TDSVISLQK

Amino Acids from 5' Exons

ATSLMILRERLRYLQKWNIPLSIHLKLTLIQHFKFWDLQEKRLLPSQGTTEQILL,LPLSYSGRDSANTSRNNGIFHAFISHYNTSNFGISRRKGFFHPRVQQNRFCD,YLLADDTQGETPLIPPEIMEYSIKHSSEVDINTTLQILGSPGEKASSIPGYNRTDSVI

Amino Acids from 3' Exons

PSKVCSGTDSTSSSSNCKKRIIRINLQKHFSSQPVDWQSHC,LQKYVREQILLAVAVIVKRGSLDKSIDCKSIFHEVSQLISSGNPTV,FKSMFGNRFYQQLKEDHINQLTAKAFFMKSASLVVAIPL