McDonnell Genome Institute

Washington University

CircRNA

chr13|20641289|20644958|+|IFT88|ENST00000319980.10

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9065

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

17

Peptide

SLSGLEPITLTPNFGKK

Amino Acids from 5' Exons

ALPMRNIGMRLWTVSNFTQSYETVPKFFTRQI,PYLETKSARGFGLFPETSRNPTKQCRSSLPDSKY,LTYEKLNRLDEALDCFLKLHAILRNSAEVLYQIAN

Amino Acids from 3' Exons

SYRYFPCNIEVIEWLGAYYIDTQFWEKAIQYFERASLI,HIGIFLVILKSLSGLEPITLTPNFGKKLFSTLKELLLY,IVFSLYSHVAWSLLHHPILGKSYSVLKSFSYT