McDonnell Genome Institute

Washington University

CircRNA

chr13|20638331|20671039|+|IFT88|ENST00000319980.10

Cancer

Type of Peptide

CCRC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.959

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

AVGAPVAK

Amino Acids from 5' Exons

GKDFAQASSYADIAVNSDRYNPAALTNKGNTVFANGDYEKAAEFYKEALRNDSSCTEALYNI,ERILHKPAAMQILTLIDIIQQLLLIKGIQFLQMVIMRRPLNSIKRLEMILLVLKHFIIL,KGFCTSQQLCRYSCELISSSSYREYSFCKWLEGRILRGSKKFFLYSTLY

Amino Acids from 3' Exons

RIKSGRDGSGGSRGKREGSASG,ASQAEMAVGAPVAKEKEVLAV,HKVRQRWQWGLPWQKRRKCR