McDonnell Genome Institute

Washington University

CircRNA

chr13|113823374|113828711|-|GAS6|ENST00000327773.6

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9367

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

8

Peptide

QISVEELAR

Amino Acids from 5' Exons

CGPLWTSGLNQPGKKSWLTSAQPQTQACCLRSGPPTSVPCLSLWHWTITPRRNSRS,ADPSGRRDINLGSRSRGSHPPSRRHRRAVCALGPRPPCRASLCGTGRLSLHEETQEA,RTPLDVGTESTWEVEVVAHIRPAADTGVLFALWAPDLRAVPLSVALVDYHSTKKLKKQ

Amino Acids from 3' Exons

ISVEELARNLVIKVNRDAVMKIAVAGDLFQPERGLYHLNLTVGGIPFHEKDLVQP,SLLRSWRGIWSSRSTGMLSKSRWPGTCSNRSEDCIITPWEVFPSMRRTSCS,LCGAGAESGHQGQQGCCHENRGGRGLVPTGARTVSSEPDRGRYSLPEGPRAA