top of page

McDonnell Genome Institute

Washington University

CircRNA

chr13|113534044|113548452|+|TMCO3|ENST00000434316.6

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.996

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

12

Peptide

SASFPLSWGAGR

Amino Acids from 5' Exons

HCRGSSPNPGFDWSDSFFTSGGFSFMSCYKEVSHWTLLSEAAHGKQGEQRNPDLGNICLYLLNVN,IVVEVLRILVLIGQILFSLAAVFLLCLVIKKYLIGPYYRKLHMESKGNKEILILGISAFIFLMLT,LSWKFSESWFLVRFFFHRRFFFYVLLRSISLDPIIGSCTWKARGTKKSSWEYLPLSSC

Amino Acids from 3' Exons

FLLAALVLSLILPRSSQYIKWIVSAGLAQVSEFSFVLGSRARRAGVISRE,FSWRRWSCLSFCRGAASTSSGSSLRGLPRSASFPLSWGAGREERASSLG,SPGGAGPVSHSAEEQPVHQVDRLCGACPGQRVFLCPGEPGAKSGRHLSG

bottom of page