McDonnell Genome Institute

Washington University

CircRNA

chr13|113495501|113503588|+|TMCO3|ENST00000375391.5

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

1

Peptide

GGGAACDQTAPR

Amino Acids from 5' Exons

LKMCVHASSVGQRPVDCCALPSGPGSRCWEEASSGCCFPSFPGRCRLWSTRRWRSVSNCTAGEGWLPCRAGSGSGTAAGSSQGFSARRMQFTNKLQLEQWRKTWACRMKRNCFRCTRLKFSRKSMKVKIPFSKLSTDCREPCRGITKMSTRRAAGSAWRPERLQ,KCVSDMQAQWGRDPWIAVPCPPDLDHEGVGKKLLLGAVSRPSLGGAGCGARGGGAACDQTAPRARGGCHAEPAVGPGQLQEALRASPPEECSSEQTENCNWSSGERRGPVGRETVSGAHVNFPERAEKKFRFPSCLRTAESPAGGLQRCREHEGEQPAAPGGPERGCNK,ENVCLTCKLSGAETRGLLCPALRTWIMKVLGRSFFWVLFPVLPWAVQAVEHEEVAQRVIKLHRGRGVAAMQSRQWVRDSCRKLSGLLRQKNAVLNKLKTAIGAVEKDVGLSDEEKLFQVHTFEIFQKELNESENSVFQAVYGLQRALQGDYKDVVNMKESSRQRLEALREAAIK

Amino Acids from 3' Exons

SIVQVETLGEFGVFFTLFLVGLEFSPEKLRK,LLCKWRHENLGCFLLFFLLANFLQKSE,YCASGDIRRIWGVFYSFSCWLRIFSRKAKK