McDonnell Genome Institute

Washington University

CircRNA

chr13|113424216|113433867|-|ADPRHL1|ENST00000356501.8

Cancer

Type of Peptide

BRCA-Luminal A

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9706

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

8

Peptide

AMFHGGSGFGAATK

Amino Acids from 5' Exons

TYRKWSSEGRGGRRGHDAPMIAYDALLAAGNSWTELCHRAMFHG,PTGSGARKVEGEDEATMPPPMTPSLQQETAGLSCVTGPCFME,LQEVELGRSRGKTRPRCPHDSLRPPCSRKQLDAVSPGHVSW

Amino Acids from 3' Exons

AQGLERPPRPCASACGTGSLSGWRPSSRSAWSAAGPTTIPQ,LRVWSGHQGHVHRPAVLEAAAGDPHRGQRGVRPDDPQPSH,SGFGAATKAMCIGLRYWKPERLETLIEVSVECGRMTHNHPT