McDonnell Genome Institute

Washington University

CircRNA

chr13|113242967|113255125|+|CUL4A|ENST00000326335.8

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9844

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

2

Peptide

ETTFGTAIVINPEK

Amino Acids from 5' Exons

TFGTAIVINPEKDKDMVQDLLDFKDKVDHVIEVCFQKNERFVNLMKESFETFINKRPNKPAELI,LLEQRSSILRKTKTWSKTCWTSRTRWTTSRSASRRMSGSSTRSPLRRSSTRDPTSLQNS,FWNSDRNQSERQRHGPRPVGLQGQGGPRDRGLLPEEAVRQPDEGVLDVHQQETQQACRTD

Amino Acids from 3' Exons

RIVNCAERCSPWPVAKHVCLKVPKERKWKMETSSFLMESSSTSCLERSIKFRRK,GIAQNAAVPGLWQSTCADKSQRKGSGRWRQVHFWRVQAQVVNKDQSNSDEGN,DSELRRTLQSLACGKARVLIKSPKGKEVEDGDKFIFNGEFKHKLFRIKINQIQMKET