McDonnell Genome Institute

Washington University

CircRNA

chr13|112854278|112854530|+|ATP11A|ENST00000375630.6

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9626

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

4

Peptide

DNLSGLQEK

Amino Acids from 5' Exons

AAGESCRHHRGPAEGRDQSLGSHGRQDGDGRGHVLRLQALPQEHAAAGADHQEDRGAEPARRPVRAEQDGPAPQREPDQRQPVR,LQEKAADTIEALQKAGIKVWVLTGDKMETAAATCYACKLFRRNTQLLELTTKRIEEQSLHDVLFELSKTVLRHSGSLTRDNLS,CRRKLQTPSRPCRRPGSKSGFSRETRWRRPRPRATPASSSAGTRSCWSPPRGSRSRACTTSCSSARRSCATAGAPETTCP

Amino Acids from 3' Exons

AAGESCRHHRGPAEGRDQSLGSHGRQDGDGRGHVLRLQALPQEHAAAGADHQEDRGAEPARRPVRAEQDGPAPQREPDQRQPVR,LQEKAADTIEALQKAGIKVWVLTGDKMETAAATCYACKLFRRNTQLLELTTKRIEEQSLHDVLFELSKTVLRHSGSLTRDNLS,CRRKLQTPSRPCRRPGSKSGFSRETRWRRPRPRATPASSSAGTRSCWSPPRGSRSRACTTSCSSARRSCATAGAPETTCP