McDonnell Genome Institute

Washington University

CircRNA

chr13|112519885|112527484|-|TUBGCP3|ENST00000261965.7

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.931

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

10

Peptide

LLEFFVASDPTVK

Amino Acids from 5' Exons

TRTCPSSYDFVSALDWNSRNRCQSHQRTVQSDPAKAGRAAAG,PELVRPATTLYQHNLTGILETAVRATNAQFDSPEILRRLDVRLLE,QNLSVQLRLCISITLEFKPLSEPPTHSLTVLRSCEGWTCGCW

Amino Acids from 3' Exons

FFVASDPTVKTDRLWHDKYTLRKSMIPSFMTMDQSRK,FLHQIQQLKQIDCGTTSILGNRFLRLRWISLG,FCSIRSNSNRSTVARQVYFEEIDDSFVYDDGSVE