McDonnell Genome Institute

Washington University

CircRNA

chr13|111283138|111288443|+|ARHGEF7|ENST00000218789.9

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9269

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

5

Peptide

QTLNSTPLPPGHSVQQAR

Amino Acids from 5' Exons

LPSHPVTPSSKHADSKPAPLTPAYHTLPHPSHHGTPHTTINWGPLEPPKTPKPWSLSCLRPAPPLRPSAALCYKE,SPPTRSLRPASTQTASPRRRPPTTRCPTPPTTAPRTPPSTGDPWSLRKHPSPGAAACGPRLPSGPQLLSATR,PLPPGHSVQQARRQQARAADARLPHAAPPLPPRHPAHHHQLGTPGASENTQALEPELPAARASPPALSCSLLQG

Amino Acids from 3' Exons

AQLLWKKMLRFKSLKLTAPAPKQGKHSIQ,HSCFGRRCSDSESHSLLHQRQNKANTQF,TAALEEDAQILKVIEAYCTSAKTRQTLNS