McDonnell Genome Institute

Washington University

CircRNA

chr13|110676973|110683134|-|CARS2|ENST00000257347.8

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9503

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

7

Peptide

AGTSSALPSLGNVYFDLK

Amino Acids from 5' Exons

RTLTSVMPVTSPCGRRPNPRRCSGPLPGDPGGRAGTSSALPSL,GLQASCQLRPVEGGQTPGGVLGLSLGTREAGLAHRVLCHR,DSDKRHASDFALWKAAKPQEVFWASPWGPGRPGWHIECSAIA

Amino Acids from 3' Exons

AMSTSISLEETSMANWSAWSLVQSESQ,QCLLRSEVRRQVWQIGRRGPWSSRRA,NVYFDLKSRGDKYGKLVGVVPGPVGEP