McDonnell Genome Institute

Washington University

CircRNA

chr13|109120369|109141376|+|MYO16|ENST00000356711.6

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9555

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

19

Peptide

AAGGVEPAVPAVLQEPEGR

Amino Acids from 5' Exons

MGVRKVFLKYWHADQLNDLCLQLQRKIITCQK,WESEKCFNTGMLTNSMICAYSCREKLPAKK,GSPKSVSKILACPTQFVPTVAEKNYNLPK

Amino Acids from 3' Exons

LWPGPDRTATTTAPRRFLLESPSAAPTPSSAAPTRRYRGPGPGTRGPRAPRGQQRAFPPGLRSARCPRRRLRVTRTTASLCTSRCWGTRPGPIARTPGSPCTRRSVACPTTAARARAPSCSTAHRRPCSTARRRTRRRGPQGTRATSRRPSPTCCRTGRPCWCSPRPPSPAPPPPTSRPHPWRRSCQSWRPTSSTPCSRRGRARCPRSTPRARRATATGPRPPAWRCSTGPAEPPRRPRRPRPRPRPGRPPRPTGPARTWPSRRSPPRTRGKRGRAQRRPRFTQSQTLPPWPGPAAPSPRSHIPPRPPGRTPGRPAPVPRPPRPTALPAPGLSAAPWTSSPASSTRGGVCFGNPRREEKSGKQK,SGPAQTAQRRLQHHEEDSSSKAQAQPQHQAQRLLRGDIGVPARGREARGRPGGSSARSDPRDSAVRAAPGGASGRGRQRACVHRDAGARGQARPGPRGVRVRGDEVLPARRRRPGRGLLPAPRRIAAPAPPRAGGRGGGAPRGRVRHPAALPQPAAAPAAPAGVPPDPRHLLPRLRRVAPDTPGGEEAASPGDQPQVPRAAGGVEPAVPAVLQEPEGRRRQARVPRPGAVQRVRPSLPAVHAAPAPAPARAAPRALQALRALGLPAGARPGERGESGAERRGAQGSPKAKLCPRGRALQLLPQDPIFPREGHQGGRQEGRLQCLAPRALQPSQLQASQQPPGRARQPLQLGEECASEIRGGKKNQGSR,LARPRPHSDDYSTMKKIPPRKPKRSPNTKLSGSYEEISGSRPGDARPAGAPGAAARVLTPGTPQCALPPAAPPGDEDDSEPVYIEMLGHAARPDSPDPGESVYEEMKCCLPDDGGPGAGSFLLHGASPPLLHRAPEDEAAGPPGDACDIPPPFPNLLPHRPPLLVFPPTPVTCSPASDESPLTPLEVKKLPVLETNLKYPVQPEGSSPLSPQYSKSQKGDGDRPASPGLALFNGSGRASPPSTPPPPPPPPGPPPAPYRPCAHLAFPPEPAPVNAGKAGPSAEAPKVHPKPNSAPVAGPCSSFPKIPYSPVKATRADARKAGSSASPPAPYSPPSSRPLSSPLDELASLFNSGRSVLRKSAAGRKIREAE