McDonnell Genome Institute

Washington University

CircRNA

chr13|102647206|102663744|+|TPP2|ENST00000376052.4

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9644

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

8

Peptide

LHQLDAEKPK

Amino Acids from 5' Exons

PKSGEVTPSCPLLCELLYESEFDSQLWIIFDQNKRQMGSGDAYPHQ,PRVGKLQAAHYFVNYYMNLNLTANCGLFLTRTKDRWVQAMPIHI,QEWGSNSKLPTTLTIIIIQPTVDYFPEQKTDGFRRCLSTS

Amino Acids from 3' Exons

AGFHLRIERNISLSSSVRCTTSSIGCK,LDSSDIYNELKETYPNYLPLYVARLHQLDAEK,WILVTFITNKKHILIIFLCTLHDFINWMLK