McDonnell Genome Institute

Washington University

CircRNA

chr12|98677424|98715552|+|APAF1|ENST00000357310.5

Cancer

Type of Peptide

BRCA-Luminal B

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9751

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

LLFQVLMMLK

Amino Acids from 5' Exons

KQKKHHESFPLSCPPPHRCCLPCLLFGWSENSFLWSNLT,NKKNITNLSRLVVRPHTDAVYHACFSEDGQRIASCGADKTLQ,TKKTSRIFPALSAPTQMLFTMPAFLRMVRELLVELIKPY

Amino Acids from 3' Exons

ILELVNNRIFQSRFQHKKTVWHIQFTADEKTLISSSDDAEIQ,FNLTIESSSPGFSTRKLYGTSSSQPMRRLLFQVLMMLKF,FRTCKQNLPVQVSAQENCMAHPVHSREDSYFKFCNS