McDonnell Genome Institute

Washington University

CircRNA

chr12|98649486|98671719|+|APAF1|ENST00000357310.5

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9874

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

10

Peptide

SIMECFTWNGLR

Amino Acids from 5' Exons

GQSCVKVEYHRGQLFLSQGRSWMQFSRSSPNKVNQDGSPYMEWQAVGSLYLQKLLEIIPFK,KDSPVRWSTTEASCFCHKEEAGECNSAEALQIERTRMGHHTWNGRLWEVCISCRSCRSFPFR,RTVLCEGGVPQRPVVFVTRKKLVNAIQQKLSKLKGEPGWVTIHGMAGCGKSVLAAEAVRDHSLLE

Amino Acids from 3' Exons

DCAVSENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVYQQAKLQAKQEVDNGMLYLEW,IVQSVRIFRSFYLMDTFLDDSHFLILYNWVSVSRKLQKFISKLSCRPSRRSIMECFTWNG,LCSQEFSGVFIFKWTPSWTTAISYCTTGSLAGNFRSLSASAAGQAGGRWNALPGMD