McDonnell Genome Institute

Washington University

CircRNA

chr12|96589426|96626939|+|CFAP54|ENST00000524981.8

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9174

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

LVTMNWLR

Amino Acids from 5' Exons

VAYQVGNYELAKKVFSPVWDYFVASPLQDEQSVICLSNIITITQR,LPIKLVTMNWLRKFSHQFGIILLLRHFRMNNLLFVAILLLHKE,CLSSWLIGESFLTSLGLFCCFATSGTICYLFKQYNYYYTKK

Amino Acids from 3' Exons

LNLSKNQDFWNSLHKLCNAMRKNFILWRQLLSMTSK,YEIAKTKISGILYTSYAKMHEGKISSYGRGNNSCPLLEK,MKFKQKPRFLEFFTQVMLKCMNEEKFHLMVEVTTPVHDFLK