McDonnell Genome Institute

Washington University

CircRNA

chr12|93572684|93573036|+|SOCS2|ENST00000340600.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9994

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

9

Peptide

ELGQTGDQWVTAAAR

Amino Acids from 5' Exons

AISGPRLRGTLSSVLQDLGRKSPIPSLSATISDTPQGLVLGFALTSRKDANPSLTPARAATCLCRGDPSLMTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQT,RSVGDRGCEGLCHPSSRIWGERAPSLLSLPPFRTPRRDSFWDSHLQGRTRTLLPQLGRPPVFAAVTLLSPCGALSPPGMAGKGRGASGGPRGRRRSHPRRRRVWRRPCGSSVRQ,DQWVTAAARDFVIRPPGSGEKEPHPFSLCHHFGHPAGTRFGIRTDFKEGREPFSDPSSGGHLSLPRPFSHDPAVPALREWRGRDAEPVGDRGVGGGAIPAGGASGEGPAGARSD

Amino Acids from 3' Exons

AISGPRLRGTLSSVLQDLGRKSPIPSLSATISDTPQGLVLGFALTSRKDANPSLTPARAATCLCRGDPSLMTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQT,RSVGDRGCEGLCHPSSRIWGERAPSLLSLPPFRTPRRDSFWDSHLQGRTRTLLPQLGRPPVFAAVTLLSPCGALSPPGMAGKGRGASGGPRGRRRSHPRRRRVWRRPCGSSVRQ,DQWVTAAARDFVIRPPGSGEKEPHPFSLCHHFGHPAGTRFGIRTDFKEGREPFSDPSSGGHLSLPRPFSHDPAVPALREWRGRDAEPVGDRGVGGGAIPAGGASGEGPAGARSD