McDonnell Genome Institute

Washington University

CircRNA

chr12|92826165|92832850|-|EEA1|ENST00000322349.12

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9916

39

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

8

Peptide

EAQTLTENLLK

Amino Acids from 5' Exons

LKEKVTNSTELQHQLDKTKQQHQEQQALQQSTTAKLREAQ,RKKLQILQNCSINIKQSNSIKNNRLFSKAPRQNFEKL,EGKSYKFYRIAASIRNKATASRTTGSSAKHHGKTSRSS

Amino Acids from 3' Exons

TLTENLLKKEQDYTKLEEKHNEESVSKKNIQATLHQKDLDCQQLQSRLSASETSLHRIHVELSEKGEATQKLKEELSEVETKYQHLKAEFKQLQQQREEKEQHGLQLQSEINQ,PQKTCKKNKTILSRRNIMKNLVKRIFRQPFIKKTIVNSFSQDCLHLKPHCIEYMNVKKEKLLKSSKKNYLRRPSTSIRRSLSSYNNREKKRSSMGYNSKVKLI,LDRKLAEKRTRLYVRGETRICEKEYSGNPSSKRPRLSTASVKIVCINLTANTCRTKKRRSYSKAQRRIIGRDQVPASKGGVAATTTERRKGAAWVTTPKNS