McDonnell Genome Institute

Washington University

CircRNA

chr12|92802403|92809156|-|EEA1|ENST00000322349.12

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9254

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

AAILDLK

Amino Acids from 5' Exons

SIQYKIGSTEKISPKYQAKAYQARGRKKNPETRFNFKSRNKDSAGIEQNSNNSNRTTKSENGERSFNDRAFYSKGQTIKSFFFEKLKIKGESERKSRYIRL,VSSTRLDLQKKSEALESIKQKLTKQEEEKKILKQDFETLSQETKIQHEELNNRIQTTVTELQKVKMEKEALMTELSTVKDKLSKVSDSLKNSKSEFEKENQKGKAAILDL,YPVQDWIYRKNLKPLKVSSKSLPSKRKKKKSNKILKLVKKQRFSMRNITEFKQQQNYKKKWRKKLQSFLQRTNYQKFLILKTLKVNLKRRIRKEKPLYT

Amino Acids from 3' Exons

KLEADSLEVKASKEQALQDLQQQRQLNTDLELRATELSKQLEMEKE,NKLIVLKLKQARSRLCKIYNSKDSTQISSEPQNVNNLKWRRK,TRSSSSKQGAGFARSTTAKTAEHRFRAQSHRIETTNGEGN