McDonnell Genome Institute

Washington University

CircRNA

chr12|91158295|91164717|-|DCN|ENST00000052754.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9496

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

3

Peptide

VTFNGLNQMIVIGLDK

Amino Acids from 5' Exons

ALILVNNKISKVSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVI,HFLSTIKLAKLVLEHLHLWSWNDFICPRISRNCQKKCPKLFRSCVPMRMRSPKCEKLLSMDTRLS,IDSCQQNQSSWSIYTFGEVGTTLSVQESAEGIARKNAQNSSGAACPEDHQSAKSYFQWTEPDDCH

Amino Acids from 3' Exons

VWTKCQRIFPLTQLCTCKTTKPKSKMETLRTRTF,SGQSAKGSSPHNSARPAKQQNNRNQRWRLEPEEPS,LDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLH