McDonnell Genome Institute

Washington University

CircRNA

chr12|91157074|91164717|-|DCN|ENST00000052754.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9925

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

3

Peptide

IADTNITSIPQGLDK

Amino Acids from 5' Exons

NWAPIRRAQELKMGLSRERSSPTSALLIPISPAFLK,TGHQSAEELRNKWGFPGNEEALLHPHCYQYHQHSS,LGTNPLKSSGIENGAFQGMKKLSYIRIADTNITSIPQ

Amino Acids from 3' Exons

VWTKCQRIFPLTQLCTCKTTKPKSKMETLRTRTF,SGQSAKGSSPHNSARPAKQQNNRNQRWRLEPEEPS,LDKVPKDLPPDTTLLDLQNNKITEIKDGDFKNLKNLH