McDonnell Genome Institute

Washington University

CircRNA

chr12|9093464|9101674|-|A2M|ENST00000318602.11

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9655

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

DLGFGGGK

Amino Acids from 5' Exons

SQMWEEAMHAWCMLKSLTRRPYESTSLRHGSGIWWW,VRCNGKRPCTPGACRASHGDRTKVLPDMDLGFGGGK,SDVMGRGHARLVHVEEPHTETVRKYFPETWIWDLVVV

Amino Acids from 3' Exons

VNYKDRSPCYGYQWVSEEHEEAHHTAYLVFSPSKSFVHLEPMSHELPCGHTQTVQAHYILNGGTLLGLKKLSFYYL,SITRIVVPVTATSGCQKNTKRHITLLILCSPQARALSTLSPCLMNYPVAILRQSRHIIFMEAPCWGRSSPSII,QLQGSSLLRLPVGVRRTRRGTSHCLSCVLPKQELCPPAHVSTTLWPYSDSPGTLYSEWRHPAGAEEALLLLS