McDonnell Genome Institute

Washington University

CircRNA

chr12|9089199|9091429|-|A2M|ENST00000318602.11

Cancer

Type of Peptide

GBM

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9674

6

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

19

Peptide

LSISSAGVAEVGVTVPDTITEWK

Amino Acids from 5' Exons

PEGLEKETTFNSLLCPS,LKDRRKQHSTPYFVHQ,RTREGNNIQLPTLSI

Amino Acids from 3' Exons

LSRCGGRSNSPHHHRVEGRGLLPVRCWTWYLFHCLSPSLPALLCGAHNALLCDSWRGLHTQGHGPKLPSQMHP,SAGVAEVGVTVPDTITEWKAGAFCLSEDAGLGISSTASLRAFQPFFVELTMPYSVIRGEAFTLKATVLNYLPKCIR,QQVWLREQSLTPSPSGRQGPSACLKMLDLVSLPLPLSEPSSPSLWSSQCLTLFVERPSHSRPRSTTFPNAS