McDonnell Genome Institute

Washington University

CircRNA

chr12|89626453|89634903|-|ATP2B1|ENST00000261173.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9402

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

16

Peptide

AGDLLPADGILIQGNDLK

Amino Acids from 5' Exons

QKPRMVQPWKCSHRVKKVEMVMKKIKRKQICQKRKNLFYKGNLQNWLFRLAKQ,KSPGWCSHGNAAIEERRWRWKRKESKFAKKGKICFTRETYKTGCSDWQS,KAQDGAAMEMQPLKSEEGGDGDEKDKKKANLPKKEKSVLQGKLTKLAVQIGKA

Amino Acids from 3' Exons

VIFFQLTAYLFKATILKLMKAHLVNQIMLKSLIRIPYFYQ,SSSSRHTYSRQRSNKLIDWIRSCKVFRGSLTSI,DLLPADGILIQGNDLKIDESSLTGESDHVKKSLDKDPLLLS