McDonnell Genome Institute

Washington University

CircRNA

chr12|89601325|89604346|-|ATP2B1|ENST00000261173.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9266

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

9

Peptide

MGTLLWGQGIAGTDVAK

Amino Acids from 5' Exons

IIIVQFGGKPFSCSELSIEQWLWSIFLGMGTLLWGQ,LCSLVENLSVVQNFQNSGYGQYSEWEHYSGA,NNCAVWWKTFQLFRTFNRTVAMVNIPRNGNITLGP

Amino Acids from 3' Exons

GIAGTDVAKEASDIILTDDNFTSIVKAVMWGRNVYDSISKFLQFQLTVNVVAVIVAFTGACITQ,VLLELMLKKHPILFSQMTTLQALLKQLCGDEMSMTASQNSFSSNLLLMQLLLLRAPALL,YCWNCSRSIRYYSHRQLYKHCSSYVGTKCLQHLKIPSVPTYCCSSSDCCFYGRLHYS