McDonnell Genome Institute

Washington University

CircRNA

chr12|894561|897681|+|WNK1|ENST00000315939.10

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9144

26

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

5

Peptide

SPQLSVSQVK

Amino Acids from 5' Exons

FLKSKKALSQLVQELVFLRWDDF,FSSQRRPCPSNFRSWCFDGTIS,SQVKEGPVLATSSGAGVFKMGRFQ

Amino Acids from 3' Exons

TSQRDSGPAESPEANIFVYQTGQGAPCCYYSPSCSPFREKTTTHKQRQQISKQFLGEKPPAF,HLKEIQDLQSRQKHEIESLYTKLGKVPPAVIIPPAAPLSGRRRRPTKSKGSKSSRSSSLGNKSPQLS,ISKRFRTCRVARSMKLNLCIPNWARCPLLLLFPQLLPFQGEDDDPLKAKAANLVEAVPWGIKAPSFQ