McDonnell Genome Institute

Washington University

CircRNA

chr12|883773|897681|+|WNK1|ENST00000315939.10

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9621

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

5

Peptide

SPQLSEIGR

Amino Acids from 5' Exons

KLEGEFKQPIPASSMPQQI,NWKESSNNQFLRLPCHSK,IGRRVQTTNSCVFHATAN

Amino Acids from 3' Exons

TSQRDSGPAESPEANIFVYQTGQGAPCCYYSPSCSPFREKTTTHKQRQQISKQFLGEKPPAF,HLKEIQDLQSRQKHEIESLYTKLGKVPPAVIIPPAAPLSGRRRRPTKSKGSKSSRSSSLGNKSPQLS,ISKRFRTCRVARSMKLNLCIPNWARCPLLLLFPQLLPFQGEDDDPLKAKAANLVEAVPWGIKAPSFQ