McDonnell Genome Institute

Washington University

CircRNA

chr12|88154287|88166582|+|TMTC3|ENST00000266712.10

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9966

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

4

Peptide

TVLMVTGVVGR

Amino Acids from 5' Exons

VTGVVGRAELLSSIFFLAAFLSYTRSKGPDNSI,QELLEEQNFCHLSFFQLFCHIPDQKDQTIP,NRSCWKSRTFVIYLFSSSFFVIYQIKRTRQFH

Amino Acids from 3' Exons

VPSCCKPNSYKATNFLPPSCECLVVIKSFRALLLDHGNNTTYRVITRYSKSGHIYFLLFSGDVGSIQYQILWFLQDCFN,FDNPAAVSPTPTRQLTFNYLLPVNAWLLLNPSELCCDWTMGTIPLIESLLDIRNLATFTFFCFLGMLGVFSIRYSGDSSKTVLM,LITQLLAQLLQGNLLTTSFLMLGCYILQSSAVIGPWEQYHLSHYIFEIWPHLLSFVFWGCWEYSVSDTLVIPPRLF