McDonnell Genome Institute

Washington University

CircRNA

chr12|82398794|82434724|+|METTL25|ENST00000248306.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9205

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

6

Peptide

VAAGQGVIDLGSGK

Amino Acids from 5' Exons

VIDLGSGKGYLSSFLSLKYGLKVYGIDSSNTNTHGAEERNRKLKKHWKLCHAQSRLDVNGLALKMAKERKVQNKVKNKADTEEVFNNSPTNQEKMPTSAILPDFSGSVISNIRNQMETLHSQPHQEENLCFENSFSLINLLPINAVEPTSSQQIPNRETSEANKERRKMTSKSSESNIYSPLTSFITADSELHDIIKDLE,LTWVPVKATALFCPSMAKFMELILQIPILMELRRETENRNIGNSVMLSQDMSMDHKWQKKGKCKIKLKIKLILRKCLTTVLQIKKRCLPQLFCLIFLALFLISETKWKPFILSHIKKKICVLKIPFLLTFCLLMLSLLLHSKYPTEKHLKPIKREEKHQSQVNQIYIHLPLLSLLIQNSMTLLKIW,DLGFRRLPKLFFVLEVWLKSLWNFFKYQYSWSGEKQKIEETLETLSCSVKIRCQWTSIKNGKRKESAKSKSYGSVQQSYKSRKDAYLSYFAFFWLCNFYQKPNGNPSFSATSRRKFVFKFLFSYKPFAYCCRAYFFTANTQQRNISQREKKNDIKVKIKYIFTFNLFYHCFRTPHYRFG

Amino Acids from 3' Exons

ALERVAAGQG,HWSGLQLAK,IGAGCSWPR