McDonnell Genome Institute

Washington University

CircRNA

chr12|82398794|82399394|+|METTL25|ENST00000248306.7

Cancer

Type of Peptide

BRCA-HER2-enriched

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9344

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

8

Peptide

DLEVIDLGSGK

Amino Acids from 5' Exons

VIDLGSGKGYLSSFLSLKYGLKVYGIDSSNTNTHGAEERNRKLKKHWKLCHAQSRLDVNGLALKMAKERKVQNKVKNKADTEEVFNNSPTNQEKMPTSAILPDFSGSVISNIRNQMETLHSQPHQEENLCFENSFSLINLLPINAVEPTSSQQIPNRETSEANKERRKMTSKSSESNIYSPLTSFITADSELHDIIKDLE,LTWVPVKATALFCPSMAKFMELILQIPILMELRRETENRNIGNSVMLSQDMSMDHKWQKKGKCKIKLKIKLILRKCLTTVLQIKKRCLPQLFCLIFLALFLISETKWKPFILSHIKKKICVLKIPFLLTFCLLMLSLLLHSKYPTEKHLKPIKREEKHQSQVNQIYIHLPLLSLLIQNSMTLLKIW,DLGFRRLPKLFFVLEVWLKSLWNFFKYQYSWSGEKQKIEETLETLSCSVKIRCQWTSIKNGKRKESAKSKSYGSVQQSYKSRKDAYLSYFAFFWLCNFYQKPNGNPSFSATSRRKFVFKFLFSYKPFAYCCRAYFFTANTQQRNISQREKKNDIKVKIKYIFTFNLFYHCFRTPHYRFG

Amino Acids from 3' Exons

VIDLGSGKGYLSSFLSLKYGLKVYGIDSSNTNTHGAEERNRKLKKHWKLCHAQSRLDVNGLALKMAKERKVQNKVKNKADTEEVFNNSPTNQEKMPTSAILPDFSGSVISNIRNQMETLHSQPHQEENLCFENSFSLINLLPINAVEPTSSQQIPNRETSEANKERRKMTSKSSESNIYSPLTSFITADSELHDIIKDLE,LTWVPVKATALFCPSMAKFMELILQIPILMELRRETENRNIGNSVMLSQDMSMDHKWQKKGKCKIKLKIKLILRKCLTTVLQIKKRCLPQLFCLIFLALFLISETKWKPFILSHIKKKICVLKIPFLLTFCLLMLSLLLHSKYPTEKHLKPIKREEKHQSQVNQIYIHLPLLSLLIQNSMTLLKIW,DLGFRRLPKLFFVLEVWLKSLWNFFKYQYSWSGEKQKIEETLETLSCSVKIRCQWTSIKNGKRKESAKSKSYGSVQQSYKSRKDAYLSYFAFFWLCNFYQKPNGNPSFSATSRRKFVFKFLFSYKPFAYCCRAYFFTANTQQRNISQREKKNDIKVKIKYIFTFNLFYHCFRTPHYRFG