McDonnell Genome Institute

Washington University

CircRNA

chr12|8092871|8093055|+|NECAP1|ENST00000339754.9

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9002

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

9

Peptide

NLTMEAVMQNITNK

Amino Acids from 5' Exons

NITNKKGGASKPRTARGGGLSLLPPPPGGKVTIPPPSSSVAISNHVTPPPIPKSNHGGSDA,TLQTRKEVLLSPGLQGVGVAYSHPRQEAKSLFPHHPPQLPSAIMSPHHPFRNLTMEAVMQ,HYKQERRCFAQDCKGWGSELTPTPARRQSHYSPTILLSCHQQSCHPTTHSEIPWRQC

Amino Acids from 3' Exons

NITNKKGGASKPRTARGGGLSLLPPPPGGKVTIPPPSSSVAISNHVTPPPIPKSNHGGSDA,TLQTRKEVLLSPGLQGVGVAYSHPRQEAKSLFPHHPPQLPSAIMSPHHPFRNLTMEAVMQ,HYKQERRCFAQDCKGWGSELTPTPARRQSHYSPTILLSCHQQSCHPTTHSEIPWRQC