McDonnell Genome Institute

Washington University

CircRNA

chr12|8047881|8050620|+|FOXJ2|ENST00000162391.7

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.99

29

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

3

Peptide

HSHLPSSPSHSSSR

Amino Acids from 5' Exons

AFLLSWGTSHPRTTTTCISSSSHRHLNSSSSSSSRHSHLPSSPSHSSSRHLPRAPQLGVLLHCTPQAQMVVPHQGESKLGRKAMGLPLWPCIHPRCSMEATTLISTIPTPTLPSSHHLHSHRHKARLPSTTLAL,LFFSPGGHPTLEQLLHVSAAAATATSTAAAAAAAATATSPAVPATAAAGTCPGPLSCRGCSSTAHPKHRWLYPTRGKASWGGRLWASPCNGHASTPAAAWRLPPSSAPSPLPPCPAATTSTATGTRPGSHQQHWL,FSSLLGDIPPSNNYYMYQQQQPPPPQQQQQQQQPPQPPPQQSQPQQQQAPAQGPSAVGGAPPLHTPSTDGCTPPGGKQAGAEGYGPPPVMAMHPPPLQHGGYHPHQHHPHSHPAQQPPPPQPQAQGQAPINNTGF

Amino Acids from 3' Exons

TLMGTHKLPTSTLAHHQCTQSPPRTQQDTIAQ,ELLWAPTSSPPLPWPITNVPNPHPGLSRIQSP,NSYGHPQAPHLYPGPSPMYPIPTQDSAGYNRP