McDonnell Genome Institute

Washington University

CircRNA

chr12|80472104|80506670|+|PTPRQ|ENST00000614701.4

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9922

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

11

Peptide

SAPISILTEEDGR

Amino Acids from 5' Exons

VAFWITAQKTSSLHSLTHHLQCMMSILRLKPVQGLGPSQIFQYSLHQM,SHFGQHKRPQVCIHPNTIYNVCLYCGNQCRDWAQVKYFSIHSTR,RILDNSTKDLKFAFTNLTPFTMYDVYIAAETSAGTGPKSNISVFTPPD

Amino Acids from 3' Exons

YRNIPNISLRCLLVHSKVKEFGVLPVYRRKM,TEEIYPIYHGVCYTQRRSSECSHKYTDGGR,LKKYTQYIIEVSASTLKGEGVRSAPISILTEED