McDonnell Genome Institute

Washington University

CircRNA

chr12|80443751|80510443|+|PTPRQ|ENST00000616559.4

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9578

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

8

Peptide

MATTPGAK

Amino Acids from 5' Exons

NQNNLRNLEPSIFPHIPFLCTGAYPLVMWKGIKWILFLTVALLLSEILEVENI,TRTTETSLQYFHTFLFSALEPTLWSCGKVSSGSCSQWLCYYQRSWRWRIS,PEQPEKLRAFNISTHSFSLHWSLPSGHVERYQVDLVPDSGFVTIRDLGGGEYQ

Amino Acids from 3' Exons

LLILPLKTSLNSCLVSRSCHGNHPWSQMELSFITQFMS,SFSPSRLLCKTVVWCHGEVVMATTPGAKWNYPLLHSLCL,PDSPPQDFSVKQLSGVTVKLSWQPPLEPNGIILYYTVYV