McDonnell Genome Institute

Washington University

CircRNA

chr12|79817393|79872938|-|PPP1R12A|ENST00000261207.9

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9821

14

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

11

Peptide

KACIDDNVDMVK

Amino Acids from 5' Exons

IRQNPWLLLMPTLLVHKQLLLLQHLLCHQVKQHLHHLLK,DKTPGFCNCQHFYTSSSCSCYNTYCVIRSSNTYITYK,KTKPLASVTNANTSSTQAAPVAVTTPTVSSGQATPTSPIKK

Amino Acids from 3' Exons

ACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLDIA,LALMTMLIWSFWKMEQILINLIMKAGYHYMQQLPVDILILQ,LHQCYGEVSGRKWSKYSTRLDTTTCSSFLWISYCR