McDonnell Genome Institute

Washington University

CircRNA

chr12|78049992|78118297|+|NAV3|ENST00000397909.6

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9974

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

HPVKTLK

Amino Acids from 5' Exons

VKTLKQEEEQLKTQTGRIKRLCPVFVGLRAT,RPNKKNENSKHSRLEAEFRRDYVQSSWDSDKPQ,EDPETRRMRTVKNIADLRQNLEETMSSLRGTQISH

Amino Acids from 3' Exons

LRTDSEKRSTTDETWDSPEELKKPEEDFDSHGDAGGKWKTVSSGLPEDPEKAGQKASLSVSQTGSWRRGMSAQGGAPSRQKAGTSALKTP,GQIQRNAPPQTRPGIVLRNKNQKKILTAMGMLVASGRLCPLDFLKTPRRQGRKLPCLFHRQVPGEEACLPKEGRHLGRKLEQVHSKHP,EDRFRETLHHRRDLGSGTEKTRRRFQPWGCWWQVEDCVLWTSRPREGRAESFPVCFTDRFLEKRHVCPRRGAIAESWNKCTQNT