McDonnell Genome Institute

Washington University

CircRNA

chr12|76797433|76827050|+|ZDHHC17|ENST00000426126.6

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9089

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

2

Peptide

AIITMDMVNLLDGK

Amino Acids from 5' Exons

EIKPQSHYNHGYGEPLGRKTHIDDYSTWDIVKAT,KSNPKAIITMDMVNLLDGKLILMITAHGTSRLH,NQTPKPLPWIWTSWTENSYLQHMGHSQGYT

Amino Acids from 3' Exons

EFRQKVMLGTPFLVIWLVGFIADLNIDSWLIKGLMYGGVWATVQFLS,NFGRKCELLSLFGWLGLQTILILGSLKGCMVVFGLQYSFFQ,ISAESNVRNSFPSYLAGWVYSRPKYFLAHRANVWWCLGYSTVSFK