McDonnell Genome Institute

Washington University

CircRNA

chr12|76392580|76402766|-|OSBPL8|ENST00000261183.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9806

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

10

Peptide

ANNLHSGDNFHLNLNFIMAQR

Amino Acids from 5' Exons

EGAGWMLWSWLNVLVFLNVQSEKERNMTAFHQIAHMLSMAYYVLTISTVVITS,KVLDGCFGVGFEMFSSTYNDQRRKGTPERFIRHTCDFLWLTTCQSPQWLP,RCWMDALELALKCSSLLKRTMIREGKEHDLSVSSDSTHVTFYGLLRANNLHSGDNF

Amino Acids from 3' Exons

SESKLYNGSEKDSSTSSKLTKKESLK,LNLNFIMAQRRTVQLQANSQKKNLL,ITLWLREGQFNFKQTHKKRIS