McDonnell Genome Institute

Washington University

CircRNA

chr12|7483366|7483675|-|CD163|ENST00000359156.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9707

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

8

Peptide

EDAAVNCTDK

Amino Acids from 5' Exons

TRDFRKDPLPVLDVWRSGMEVPGGQCVMTLGTWTMLRWCVNNLAVVQLKHSKKQSLVRGLDRYGSMKSAKGMSLPCGIVLPDAGAIVSVGTRKTLQIAQ,QDKTSGRTHFLFWTCGDLAWRFLGDSVLLGLGRCSGGVSTTWLWSSFESIQRSRVWSGDWTDMAQSEVQREVFLVGLSCQTLGPVWAQGRRCSELH,KIRLQEGPTSCSGRVEIWHGGSWGTVCDDSWDLDDAQVVCQQLGCGPALKAFKEAEFGQGTGPIWLNEVKCKGNESSLWDCPARRWGHSECGHKEDAAVNCT

Amino Acids from 3' Exons

TRDFRKDPLPVLDVWRSGMEVPGGQCVMTLGTWTMLRWCVNNLAVVQLKHSKKQSLVRGLDRYGSMKSAKGMSLPCGIVLPDAGAIVSVGTRKTLQIAQ,QDKTSGRTHFLFWTCGDLAWRFLGDSVLLGLGRCSGGVSTTWLWSSFESIQRSRVWSGDWTDMAQSEVQREVFLVGLSCQTLGPVWAQGRRCSELH,KIRLQEGPTSCSGRVEIWHGGSWGTVCDDSWDLDDAQVVCQQLGCGPALKAFKEAEFGQGTGPIWLNEVKCKGNESSLWDCPARRWGHSECGHKEDAAVNCT