McDonnell Genome Institute

Washington University

CircRNA

chr12|7398263|7433694|-|CD163L1|ENST00000416109.2

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9816

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

7

Peptide

EDVIVTCSDGTDLELR

Amino Acids from 5' Exons

IRQIWTGLSGLIAPVMGDWRNTKESGGLCVMTDGAQGMQLLFVNNWDVESLCMCLVPILKKHQDLFGWMTFLALEMSQISGTVNTVDGESIIVYTERMLPAQ,GRSGPKACRGSPLLWEIGGEIPRRVGDCVSQMEHKECSCCLTIGMWKAFACVWYDLFRSIRTYLAGRFLHWKVKYLGLTQWMGKALCTQRGCDCNLL,KADLDLRLVGAHSPCYGRLEVKYQGEWGTVCHDRWSTRNAAVVCKQLGCGKPLHVFGMTYFKEASGPIWLDDVSCIGNESNIWDCEHSGWGKHNCVHREDVIVTCS

Amino Acids from 3' Exons

MEQIWSGWSMETVPALGQWRNSRDSGGLCVMMGGTLLPQLSCANSLDVHFLSPCFVLDKPLDMEKFGLMMFPVMEMSQLSGNVNTGNGEAITVIMEKMLVTVMVRVLEEGK,WNRFGVEAGQWRRSLLWDSGGEIPGTVGDCVWVEHYCLNCRVQTAWMSIFFRHVSFWTSRDTWKNLACFLLWKVSSLGMSTPGMGKPLLSWRRCWCELLWESNSRKA,GTDLELRLVNGDGPCSGTVEVKFQGQWGTVCDDGWNTTASTVVCKQLGCPFSFAMFRFGQAVTRHGKIWLDDVSCYGNESALWECQHREWGSHNCYHGEDVGVNCYGKSLTRVGRQ