McDonnell Genome Institute

Washington University

CircRNA

chr12|71642435|71645075|-|ZFC3H1|ENST00000378743.7

Cancer

Type of Peptide

BRCA-Luminal B

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9063

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

2

Peptide

LIVEEAFISMITMK

Amino Acids from 5' Exons

SSDPDLRRSLDKQPTDSGGGIYQYDNYEEVAMDTDSETSSP,LQILTGDPISNLLIVEEAFISMITMKKLLWIQIVKPVLQ,FRSPEAILRATYWRRHLSVLRSCYGYRNQFS

Amino Acids from 3' Exons

KLGEDEEELSELQLRLLALQSASKKWQQKEQQVMKESKEKLTKTKTVQQKVKTSTKTHSAKKVSTT,NLVKMKRNYLNYSFAFWLFSQPVKNGNKKNSRKKAKKSLRRKLYSKKLKQVQKHIRPKKLALQ,TWRRGTIITASPFGSSVSQKMATKRTAGDERKQRKVDDENCTAKSNKYKNTFGQKSHY