McDonnell Genome Institute

Washington University

CircRNA

chr12|71619925|71629037|-|ZFC3H1|ENST00000378743.7

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.996

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

3

Peptide

LLLHYICK

Amino Acids from 5' Exons

VGCNGALIFIGIMSYLPVAGSSCCIIFANKSAQSQSSVAYCIKKSSECRGFLSYVQILHLT,YEAAMELCKSLLESCPINCQLLEALVALYLQTNQHDKARAVWLTAFEKNPQNAEVFYHMCKFFILQ,MRLQWSFVNLYWNHVLLTASCWKLLLHYICKQISMTKPEQCGLLHLKKILRMQRFFIICANSSSY

Amino Acids from 3' Exons

LLHLQPTKIKESGSQSFGENLFQIIASVVMRNSLQDQLSM,SSIYNLQRKKVEAKVLEKTYFRLQGTVYRTNV,PPFTTYKDKRKWKPKFWRKPISDNSFSSDEEQSTGPIKY