McDonnell Genome Institute

Washington University

CircRNA

chr12|7135326|7138067|+|CLSTN3|ENST00000266546.10

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9629

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

16

Peptide

LSTAVGLPSSTGPCLR

Amino Acids from 5' Exons

GHCACAGQRCERVCPSVCGTAVSCGCDRGEAVRSHPAGGSHRLLPPVQPDLLLDSHTQHPFPHQ,ATVHVRVNDVNEFAPVFVERLYRAAVTEGKLYDRILRVEAIDGDCSPQYSQICYYEILTPNTPFLIDND,PLCMCGSTMTSLPQCLWNGCIVRLQRGSCTIASCGWKPLTVTAPPSTARSATMRFSHPTPLSSLTMT,GHCACAGQRCERVCPSVCGTAVSCGCDRGEAVRSHPAGGSHRLLPPVQPDLLLDSHTQHPFPHQ,ATVHVRVNDVNEFAPVFVERLYRAAVTEGKLYDRILRVEAIDGDCSPQYSQICYYEILTPNTPFLIDND,PLCMCGSTMTSLPQCLWNGCIVRLQRGSCTIASCGWKPLTVTAPPSTARSATMRFSHPTPLSSLTMT

Amino Acids from 3' Exons

RTASLTTRLSTAVGLPSSTGPCLRVPAQSSSSGSWS,GRLLSLLADCPRLDCLPLLAPAECPPSQVPLEAGA,DGFSHYSLTVHGCRIAFLYWPLLESARPVKFLWKLEQ,RTASLTTRLSTAVGLPSSTGPCLRVPAQSSSSGSWS,GRLLSLLADCPRLDCLPLLAPAECPPSQVPLEAGA,DGFSHYSLTVHGCRIAFLYWPLLESARPVKFLWKLEQ