McDonnell Genome Institute

Washington University

CircRNA

chr12|70589963|70636066|-|PTPRB|ENST00000334414.10

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

14

Peptide

TIQNQQWMWTEDEK

Amino Acids from 5' Exons

FQTKLQTWRQTIMAGGLLAGRPLLETGSSIGSYSSMILWCCSTSLWERKKHSMSWMTRGSYREDSMRWKSLLRVEIRILSVAKAGQ,SRQSCKPGGKQWQDEVSCSELVAPCWRLGAVSDPTLQFCGAAQHHCGKGRNTVCHGHGARTGKTVGGSHCEWKFEEFALPRQD,PDKVANLEANNNGRMRSLVVSWSPPAGDWEQYRILLFNDSVVLLNITVGKEETQYVMDDTGLVPGRQYEVEVIVESGNLKNSERCQGRT

Amino Acids from 3' Exons

KGFRLSMSRNNSVFSKMRKWSWAHATGPSRTSSGCGLRMKSSFMLNLHCAWPSPTLPAAPPAQPSWTAVPRHPDGPAMIRKASLRWKMPLSFSRNKAPEWSRRPGNTSIAGKMSTRRENWSMKASVYKK,RVSDCPCPETTVSFQKESGRGLMQQDHPEPAVDVDGKAPSCICTVLGHLQLFPRPLPLSHLGPLFPGTPMDLLSGRLPGGKCLSLSPETRLQSSGQEGQEIPPLDENRCQQGGKTGQKPLFTK,GFQIVHVQKQQCLFKNEKVVVGSCNRTIQNQQWMWTEDEKLLHVKSALCLAISNSSRGPSRSAILDRCSQAPRWTCYDQEGFLEVENASLFLQKQGSRVVVKKARKYLHSWMKIDVNKEGKLVNESLCLQK