McDonnell Genome Institute

Washington University

CircRNA

chr12|6917580|6918162|+|ENO2|ENST00000229277.5

Cancer

Type of Peptide

CCRC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9987

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

2

20

Peptide

DATNVGDEGGFAPNILENSEAK

Amino Acids from 5' Exons

PSLGPMPSWVCLWPCVRQGQLSGNCPCIATLLSWPGTQTSSCLC,QVWGQCHPGCVSGRVGRGSAGTAPVSPHCSAGRELRPHPACA,KFGANAILGVSLAVCKAGAAERELPLYRHIAQLAGNSDLILPVP

Amino Acids from 3' Exons

AFNVINGGSHAGNKLAMQEFMILPVGAESFRDAMRLGAEVYHTLKGVIKDKYGKDATNVGDEGGFAPNILENSE,PSTSMVALMLATSWPCRSSSSQWELRAFGMPCDVQRSTIHSRESSRTNTARMPPMWGMKVALPPISWRTVK,LQRDQWWLSCWQQAGHAGVHDPPSGSELSGCHATRCRGLPYTQGSHQGQIRQGCHQCGGRWLCPQYPGEQ