McDonnell Genome Institute

Washington University

CircRNA

chr12|68726498|68731260|+|NUP107|ENST00000229179.8

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9605

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

2

Peptide

EAGLMDEFSK

Amino Acids from 5' Exons

VWMSLANGFPKAETIYLDTCFALLTLFCFSVLWDYRP,FDGVQMAFQKQKQSTWTPASLYDSPYFVFPYSGTTDQ,LMDEFSKWLSKSRNNLPGHLLRFMTHLILFFRTLGLQTK

Amino Acids from 3' Exons

LLIREKHTNLIAFYTCHLPQDLAVAQYALFLESVTEFEQRHHCLELAKEA,FERNIQILHFIPVICLKTLLPSMHYFWKVLQNLNSATIAWSWLKKQ,FNKRETYKSYSILYLSFASRPSCCPVCIIFGKCYRITAPPLPGVGRS